PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G113200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 463aa    MW: 50936.8 Da    PI: 4.3576
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G113200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.75.9e-5061331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtd elv++yLk+k+ gkkl + ++i+ev++yk+ PwdLp k ++++++ ew+fF++rdkky++g+r+nrat +gyWk++gkd
  Brast08G113200.1.p   6 LPPGFRFHPTDVELVSYYLKRKIMGKKLCV-HAISEVELYKFAPWDLPeKsCLRSKDLEWFFFCPRDKKYPKGSRTNRATPNGYWKTSGKD 95 
                         79*************************999.88**************95347777888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++   ++++vglkktL+f++g+apkg++tdWvm eyr+
  Brast08G113200.1.p  96 RTIEL-NSRTVGLKKTLIFHEGKAPKGNRTDWVMYEYRM 133
                         *****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.12E-593156IPR003441NAC domain
PROSITE profilePS5100556.6866156IPR003441NAC domain
PfamPF023653.4E-267133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MAQTCLPPGF RFHPTDVELV SYYLKRKIMG KKLCVHAISE VELYKFAPWD LPEKSCLRSK  60
DLEWFFFCPR DKKYPKGSRT NRATPNGYWK TSGKDRTIEL NSRTVGLKKT LIFHEGKAPK  120
GNRTDWVMYE YRMEDEKLVS AGFSKDEYVL CKIFKKSGLG PRIGEQYGAP FDEDDWENLS  180
FETSVFGLSS ELQDPQAEAS VIATATVTQE PPHQPVLFSG DVNICSSEVN TASLSLFDLE  240
GPHVQASVVA TAAVFEEPPI RSQQSAQCSG VDISSSELSN APPEVDGIFW DELSKFLEDS  300
PQCDIPFGEH SGLPPMSELE AQAFEINNAD LYNELAGLAG SGELPNVEFG AIDVGFPVND  360
FEHTSSEQAI GDDYLELDDL VAPGATLSYD LPMPNNEFLQ YPLNQSSYGG HYHDGATFSS  420
AFAASGSIPP IPSFFGDMPS VPNNLVNPKY SDSSHSTLKG SF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-53215711169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3621610.0AB362161.1 Hordeum vulgare subsp. vulgare mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568407.10.0PREDICTED: NAC domain-containing protein 74-like
TrEMBLI1HJ770.0I1HJ77_BRADI; Uncharacterized protein
STRINGBRADI2G24790.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47313664
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.12e-83NAC domain containing protein 103